PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01904.1.p
Common NameEUGRSUZ_J01904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 137aa    MW: 15323.3 Da    PI: 9.8724
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01904.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.71.2e-3266119255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtpeLH rF++ave+LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  Eucgr.J01904.1.p  66 PRLRWTPELHLRFIQAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 119
                       8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-2962120IPR009057Homeodomain-like
PROSITE profilePS5129413.11162122IPR017930Myb domain
SuperFamilySSF466896.99E-1665120IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-2466121IPR006447Myb domain, plants
PfamPF002492.8E-1167118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MAAIPLEIRS EDEEEGDCES KTRNSTSSSN SIVEEFSENN NNNNKKNGIS SGTSTGLRPY  60
VRTQVPRLRW TPELHLRFIQ AVERLGGQER ATPKLVLQLM NIKGLSIAHV KSHLQMYRSK  120
KINDRGEGKN PVSIYV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01904.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032996.14e-86PREDICTED: uncharacterized protein LOC104422379
SwissprotQ700D98e-32MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A059AFK74e-97A0A059AFK7_EUCGR; Uncharacterized protein
STRINGPOPTR_0009s07890.14e-48(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-41G2-like family protein